PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H01971.1.p
Common NameEUGRSUZ_H01971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 272aa    MW: 27149.1 Da    PI: 7.3133
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H01971.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-3846106262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Eucgr.H01971.1.p  46 EQEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 106
                       68899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.6E-3348104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.26450104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2452104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
DQELEPASAA CTVMPSECAD RKPAKAPHGG HLHAAGAGAA APQPQEQEHL PCPRCDSTNT  60
KFCYYNNYNF SQPRHFCKSC RRYWTHGGTL RDIPVGGGSR KNAKRSRTGA SASSSSSSAA  120
VVLPGVAPQE HHLHAASLLL PFAGSHGGPV HLAGGDGDGK PGLNVCGSFT SLLNAHGPPG  180
FLALGGFGLG LGPGGLDEMA FGLGRGVWPF QGVGDGVGAG VGSNGGPAGI GNAWQFEGGD  240
EGGLVGGGGG GGDSCFSWPG LAISTAWSGL K*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H01971.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629222e-81KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026408.11e-122PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF3.4-like
SwissprotQ390882e-61DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A059B0U60.0A0A059B0U6_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s11790.17e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.17e-45OBF binding protein 1